SOGA2

From Wikipedia, the free encyclopedia
(Redirected from KIAA0802)
Jump to navigation Jump to search

Lua error in Module:Infobox_gene at line 53: attempt to index field 'wikibase' (a nil value). SOGA2, also known as Suppressor of glucose autophagy associated 2 or CCDC165, is a protein that in humans is encoded by the SOGA2 gene.[1][2] SOGA2 has two human paralogs, SOGA1 and SOGA3.[3][4] In humans, the gene coding sequence is 151,349 base pairs long, with an mRNA of 6092 base pairs, and a protein sequence of 1586 amino acids. The SOGA2 gene is conserved in gorilla, baboon, galago, rat, mouse, cat, and more. There is distant conservation seen in organisms such as zebra finches and anoles.[5] SOGA2 is ubiquitously expressed in humans, with especially high expression in brain (especially the cerebellum and hippocampus), colon, pituitary gland, small intestine, spinal cord, testis and fetal brain.[6]

Locus

[edit | edit source]

The SOGA2 gene is located from 8717369 - 8832775 on the short arm of chromosome 18 (18p11.22).[7]

Homology and Evolution

[edit | edit source]

Paralogs

[edit | edit source]

There are two main paralogs to SOGA2: human protein SOGA1 and human protein SOGA3.[5] SOGA1 has been shown to be involved in suppression of glucose by autophagy.[8] The rate at which orthologs diverge from SOGA2 human(measured by % identity) places the approximate duplication event of SOGA1 from SOGA2 at ~254.1 MYA and the duplication event of SOGA3 from SOGA2 ~329.1 MYA.

protein name accession number sequence length (aa) sequence identity to human protein notes
SOGA3 NP_001012279.1 947 58% conserved in ~500 N-terminal aa
SOGA1 isoform 2 NP_954650.2 1016 aa 65% conserved in first ~900 aa
SOGA1 isoform 1 NP_542194.2 1661 41% conserved across the length of sequence except ~950-1150

Orthologs

[edit | edit source]

Many orthologs have been identified in Eukaryotes.[5]

common name protein name divergence from human lineage (MYA) accession number sequence length (aa) sequence identity to human protein protein domain differences
gorilla protein SOGA2 8.8 XP_004059220.1 1586 99%
baboon protein SOGA2 29 XP_003914218 1587 98%
galago protein SOGA3 74 XP_003801047.1 1583 88% DUF4201 not present
rat CCDC165 92.3 XP_237548.6 2060 81% DUF4201 not present
mouse SOGA2 92.3 NP_001107570.1 1893 80%
house cat protein SOGA2 94.2 XP_003995077.1 1700 84% DUF4201 not present
cow CCDC166 94.2 XP_581047.5 1525 74% DUF4201 not present
African Elephant CCDC167-like 98.7 XP_003406836.1 1544 73%
zebra Finch protein SOGA2 296 XP_002193121.1 1598 69% DUF4201 not present
Red JungleFowl CCDC165 296 XP_423729.3 1600 70% DUF4201 not present
Carolina anole uncharacterized protein KIAA0802-like 296 XP_003225723.1 1839 67% DUF4201 not present
File:Divergence3.png
A graph of sequence identity to human SOGA2 as a function of time of divergence of human SOGA2 orthologs.

Distant Homologs

[edit | edit source]
common name protein name divergence from human lineage (MYA) accession number sequence length (aa) sequence identity to human protein protein domain differences
Tropical Clawed Frog uncharacterized protein C20orf117-like 371.2 XP_002942331.1 1584 39%
purple sea urchin uncharacterized protein LOC578090 742.9 XP_783370.2 1587 47% DUF4201 not present
body louse Centromeric protein E, putative 782.7 XP_002429877.1 2086 30% no shared domains
southern house mosquito conserved hypothetical protein 782.7 XP_001843754.1 1878 32% no shared domains
porkworm surface antigen repeat family protein 937.5 XP_003380263.1 2030 36% no shared domains

Homologous Domains

[edit | edit source]

SOGA2 is conserved farthest back in its N-terminal region, where it contains its three domains of unknown function.[9]

File:MSAhighlight2.jpg
A comparison of multiple sequence alignment of the N-terminal regions vs. C-terminal regions of distantly related SOGA2 orthologs. Here it is demonstrated that the N-terminal region is well conserved in organisms like the clawed frog (FROG_SOGA2) but the C-terminal region is not. Location 19 is an example of one of the 7 Leucine residue that is conserved across all orthologs.

Protein

[edit | edit source]

Protein internal composition

[edit | edit source]

SOGA2 is rich in glycine (ratio r of SOGA2 composition to average human protein is 1.723), glutamate (r = 1.647), and arginine (r = 1.357). It also has a lower than usual composition of tyrosine (r = 0.3406), isoleucine (r = 0.4430), phenylalanine (r = 0.5808), and valine (r = 0.6161).[10][11]

Primary structure and isoforms

[edit | edit source]

SOGA2 has 4 isoforms: Q9Y4B5-1, Q9Y4B5-2, Q9Y4B5-3, Q9Y4B5-4.[12]

File:Isoforms.png
A graphic depicting the 4 different isoforms of SOGA2. Isoform 1 is canonical. Modification Key: * E → ELRGPPVLPEQSVSIEELQGQLVQAARLHQEETETFTNKIHK **Q → QNCCGYPRINIEEETLGFTRLPAGSTVKTLKSLGLQRLE *** NQTVLLTAPWGL → ELPCSALAPS...LHGLSQYNSL

Domains and motifs

[edit | edit source]

SOGA2 contains Domain of Unknown Function 4201 (DUF4201) from aa 16-235. This domain is specific to the Coiled Coil Domain Containing family of proteins in eukaryotes.[13] It also contains two copies of Domain of Unknown Function 3166 (DUF3166): one from aa 140-235 and one from aa 269-364.[7]

Post-translational modifications

[edit | edit source]

SOGA2 is expected to undergo a number of post-translational modifications. Modifications of human SOGA2 that are shared by orthologs include:

  • Sumoylation at amino acids 87, 152, 235, 392, and 1379.[14]
  • Sulfination at tyrosines 14 and 1249.[15]
  • Phosphorylation at a number of sites, highlighted in the following graphic:
File:SOGA2 Human Phosphorylation Sites.png
Phosphorylation sites in SOGA2 predicted by netPhos.[16] Highlighted sites are conserved as far back as African clawed frogs.

Secondary structure

[edit | edit source]

The consensus of the prediction software PELE,[17] GOR4,[18] and SOSUICoil is that the secondary structure of SOGA2 is dominated by alpha helices with interspersed regions of random coil. GOR4 indicated that SOGA2 is dominated by alpha-helices; it predicted a mere 5.61% of residues in an extended strand (parallel or antiparallel Beta-sheet) conformation, as opposed to 47.79% alpha helix and 46.6% random coils.

File:GOR4.png
Secondary structure of human SOGA2 predicted by the GOR4 tool. h corresponds to alpha helices, c corresponds to random coils, and e corresponds to extended strand

[19]

Tertiary structure

[edit | edit source]

SOGA2 shares sequence features in its highly conserved N-terminal region. This homology allows prediction of its tertiary structure on the basis of homology to published 3d structures via Phyre2[20] and NCBI structure.[21]

File:Phyre2.png
SOGA2's 3d structure predicted by Phyre2.[20] Structure is based on the crystal structure of tropomyosin at 7 angstrom resolution, with 12% identity. 283 residues match, in the CCDC containing N-terminal region.
File:Consv.png
1I84 S, Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State 3d structure. Highlighted region is conserved in SOGA2.[21]

Gene expression

[edit | edit source]

Promoter

[edit | edit source]

The promoter for human SOGA2 is below.

File:SOGA2 promoter.png
The promoter of the human SOGA2 gene.

Gene expression data

[edit | edit source]

The EST profile shows that, in humans, SOGA2 is highly expressed in many sites throughout the body, including bone, brain, ear, eye, and many others.[22] There are a large number of transcripts in liver cancer samples. Human microarray data show that SOGA2 is moderately expressed, with especially high expression in brain (especially the cerebellum and hippocampus), colon, pituitary gland, small intestine, spinal cord, testis and fetal brain.[6] Brain-tissue-specific microarray data show that SOGA2 has high expression throughout the posterior lobe of the cerebellar hemispheres and posterial lobe of the vermis in the mouse brain. There is low expression in most other areas of the brain.[23]

Transcript variants

[edit | edit source]

In humans, the SOGA2 gene produces 17 different transcripts, 8 of which form a protein product (one undergoes nonsense mediated decay). The main transcript in humans is transcript ID ENST00000359865, or SOGA2-001.[24]

Function

[edit | edit source]

Possible transcription factors

[edit | edit source]

Possible transcription factors for human SOGA2 include:[25]

  • Modulator recognition factor 2
  • cAMP-responsive element binding protein 1
  • alternative splicing variant of FOXP1
  • MDS1/EVI1-like gene 1
  • Ikaros 2, possible regulator of lymphocyte differentiation

Interactions

[edit | edit source]

Protein complex co-immunoprecipitation (Co-IP) experiments revealed interacting proteins such as cell death regulators, ATP-binding cassette (ABC) transporters and protein kinase A binding proteins.[26]

The 540 interacting proteins include ABCF1, ACTB, ACTL6A, BCLAF1, BCLAF1, CHEK1, and MAGEE2.[26]

K-nearest neighbor analysis by wolf pSort indicates that in humans, SOGA2 is focused mainly in the nucleus, cytoplasm, and the cytonuclear space. There is a small chance that it is localizes to the golgi.[27]

A number of protein interactants were also identified via the STRING database, including MARK2, MARK4, and PPP2R2B.

Clinical significance

[edit | edit source]

SOGA2 has no currently known disease associations or mutations.

References

[edit | edit source]
  1. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  2. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  3. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  4. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  5. ^ a b c Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  6. ^ a b Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  7. ^ a b Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  8. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  9. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).[permanent dead link]
  10. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).[permanent dead link]
  11. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  12. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  13. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  14. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  15. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  16. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  17. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).[permanent dead link]
  18. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).[permanent dead link]
  19. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  20. ^ a b Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  21. ^ a b Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  22. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  23. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  24. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  25. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).[permanent dead link]
  26. ^ a b Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  27. ^ Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).

Further reading

[edit | edit source]
  • Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  • Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  • Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  • Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  • Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  • Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  • Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).
  • Lua error in Module:Citation/CS1/Configuration at line 2172: attempt to index field '?' (a nil value).